Active Recombinant Full Length Human ACTN4 Protein, C-Flag-tagged
Cat.No. : | ACTN4-390HFL |
Product Overview : | Recombinant Full Length Human ACTN4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-911 a.a. |
Description : | Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | WB positive control |
Molecular Mass : | 104.7 kDa |
AA Sequence : | MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ IENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAK MTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELI EYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANR ICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEK CQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHN VNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTI EEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLV PKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDY KPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEF RASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESD LTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Systemic lupus erythematosus, Tight junction |
Full Length : | Full L. |
Gene Name | ACTN4 actinin alpha 4 [ Homo sapiens (human) ] |
Official Symbol | ACTN4 |
Synonyms | FSGS; FSGS1; ACTININ-4 |
Gene ID | 81 |
mRNA Refseq | NM_004924.6 |
Protein Refseq | NP_004915.2 |
MIM | 604638 |
UniProt ID | O43707 |
◆ Recombinant Proteins | ||
ACTN4-584HF | Recombinant Full Length Human ACTN4 Protein, GST-tagged | +Inquiry |
ACTN4-6683C | Recombinant Chicken ACTN4 | +Inquiry |
ACTN4-390HFL | Active Recombinant Full Length Human ACTN4 Protein, C-Flag-tagged | +Inquiry |
AASDHPPT-9200H | Recombinant Human AASDHPPT protein, GST-tagged | +Inquiry |
ACTN4-8099HFL | Recombinant Full Length Human ACTN4 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTN4-9055HCL | Recombinant Human ACTN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTN4 Products
Required fields are marked with *
My Review for All ACTN4 Products
Required fields are marked with *
0
Inquiry Basket