Active Recombinant Dog IL21 Protein
Cat.No. : | IL21-009D |
Product Overview : | Recombinant canine IL-21, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Description : | Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells. Implicated in the generation and maintenance of T follicular helper (Tfh) cells and the formation of germinal-centers. Together with IL6, control the early generation of Tfh cells and are critical for an effective antibody response to acute viral infection. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. |
Form : | Liquid |
Bio-activity : | The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 2 ng/mL. |
Molecular Mass : | 15 kDa |
AA Sequence : | MHKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -88 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) |
Gene Name | IL21 interleukin 21 [ Canis lupus familiaris (dog) ] |
Official Symbol | IL21 |
Synonyms | IL21; interleukin 21; IL-21; interleukin-21 |
Gene ID | 442935 |
mRNA Refseq | NM_001003347 |
Protein Refseq | NP_001003347.1 |
UniProt ID | Q6L7I9 |
◆ Recombinant Proteins | ||
IL21-362I | Active Recombinant Human IL21 Protein (132 aa) | +Inquiry |
IL21-15H | Recombinant Human IL21, His-tagged | +Inquiry |
IL21-4336R | Recombinant Rabbit IL21 Protein | +Inquiry |
IL21-01H | Active Recombinant Human IL21 Protein (aa 32-162), N-Fc-tagged | +Inquiry |
IL21-2244R | Active Recombinant Rhesus monkey IL21 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket