Active Recombinant Dog IL21 Protein

• Cat.No.: IL21-009D
• Product Overview: Recombinant canine IL-21, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Dog
• Source: E.coli
• Description: Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells. Implicated in the generation and maintenance of T follicular helper (Tfh) cells and the formation of germinal-centers. Together with IL6, control the early generation of Tfh cells and are critical for an effective antibody response to acute viral infection. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
• Form: Liquid
• Bio-activity: The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 2 ng/mL.
• Molecular Mass: 15 kDa
• AA Sequence: MHKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -88 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4)

Gene Information

• Gene Name: IL21 interleukin 21 [ Canis lupus familiaris (dog) ]
• Official Symbol: IL21
• Synonyms: IL21; interleukin 21; IL-21; interleukin-21
• Gene ID: 442935
• mRNA Refseq: NM_001003347
• Protein Refseq: NP_001003347.1
• UniProt ID: Q6L7I9