Active GMP Recombinant Porcine IL4 Protein, His-Tagged
Cat.No. : | IL4-01P |
Product Overview : | GMP Recombinant Porcine IL4 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. |
AA Sequence : | MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | IL4 interleukin 4 [ Sus scrofa (pig) ] |
Official Symbol | IL4 |
Gene ID | 397225 |
mRNA Refseq | NM_214123.1 |
Protein Refseq | NP_999288.1 |
UniProt ID | Q04745 |
◆ Recombinant Proteins | ||
il4-22Z | Recombinant Zebrafish il4 protein | +Inquiry |
IL4-138H | Active Recombinant Human IL4, His tagged | +Inquiry |
IL4-1258S | Recombinant Sheep IL4 Protein, His-B2M/MYC-tagged | +Inquiry |
IL4-36H | Active Recombinant Human IL4 Protein, Animal Free | +Inquiry |
IL4-2755H | Active Recombinant Human IL4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket