Active Recombinant Pig IL4 Protein

• Cat.No.: IL4-242I
• Product Overview: Recombinant Pig IL4 Protein without tag was expressed in CHO.

Specification

• Species: Pig
• Source: CHO
• Description: Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.25 ng/mL, measured in a cell proliferation assay using TF-1 human erythroleukemic cells, corresponding to a specific activity of >4 6 units/mg
• Molecular Mass: 15kDa, observed by reducing SDS-PAGE
• AA Sequence: HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant porcine Interleukin 4 (IL-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rpIL-4 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL4 interleukin 4 [ Sus scrofa ]
• Official Symbol: IL4
• Synonyms: IL4; interleukin 4; interleukin-4; IL-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1
• Gene ID: 397225
• mRNA Refseq: NM_214123
• Protein Refseq: NP_999288
• UniProt ID: Q04745