| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. Mice lacking a functional copy of this gene develop severe multifocal inflammatory disease, yolk sac defects and colon cancer. |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL. |
| AA Sequence : |
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein. |
