Recombinant African clawed frog tgfb1 protein, His-SUMO-tagged
Cat.No. : | tgfb1-3767A |
Product Overview : | Recombinant African clawed frog tgfb1 protein(P16176)(271-382aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | African clawed frog |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 271-382aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.6 kDa |
AA Sequence : | GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
TGFB1-057H | Active Recombinant Human TGFB1 protein | +Inquiry |
TGF-137H | Recombinant Human TGF protein | +Inquiry |
TGFB1-336H | Recombinant Human TGFB1 protein, His-tagged | +Inquiry |
TGFB1-153H | Active Recombinant Human TGFB1 Protein | +Inquiry |
Tgfb1-527G | Recombinant Guinea pig Tgfb1 protein, His & S-tagged | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tgfb1 Products
Required fields are marked with *
My Review for All tgfb1 Products
Required fields are marked with *
0
Inquiry Basket