Active GMP Recombinant Mouse Igf1 Protein, His-Tagged

• Cat.No.: Igf1-01M
• Product Overview: GMP Recombinant Mouse Igf1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. This gene is predominantly expressed in the liver and the encoded protein undergoes proteolytic processing to generate a disulfide-linked mature polypeptide. Transgenic disruption of this gene in mice results in reduced postnatal survival and severe growth retardation. Mice lacking the encoded protein exhibit generalized organ hypoplasia including underdevelopment of the central nervous system and developmental defects in bone, muscle and reproductive systems. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 10^5 IU/mg.
• AA Sequence: MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Igf1 insulin-like growth factor 1 [ Mus musculus (house mouse) ]
• Official Symbol: Igf1
• Synonyms: Igf-1; Igf-I; C730016P09Rik
• Gene ID: 16000
• mRNA Refseq: NM_001111274.1
• Protein Refseq: NP_001104744.1
• UniProt ID: E9PU89