Active GMP Recombinant Mouse Cxcl1 Protein

• Cat.No.: Cxcl1-01M
• Product Overview: GMP Recombinant Mouse Cxcl1 Protein was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <15 ng/mL.
• AA Sequence: NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >95% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl1 chemokine (C-X-C motif) ligand 1 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl1
• Synonyms: KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1
• Gene ID: 14825
• mRNA Refseq: NM_008176.3
• Protein Refseq: NP_032202.1
• UniProt ID: P12850