Active Recombinant Rat Cxcl1 Protein (72 aa)

• Cat.No.: Cxcl1-011C
• Product Overview: Recombinant Rat Cxcl1 Protein (72 aa) without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 72
• Description: All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. The GRO proteins chemoattract and activate neutrophils and basophils.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^4 IU/mg.
• Molecular Mass: 7.8 kDa, a single, non-glycosylated polypeptide chain containing 72 amino acids.
• AA Sequence: APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
• Endotoxin: Less than 1 EU/μg of rRtGRO/CXCL1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Cxcl1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Rattus norvegicus ]
• Official Symbol: Cxcl1
• Synonyms: CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); growth-regulated alpha protein; gro; C-X-C motif chemokine 1; cytokine-induced neutrophil chemoattractant 1; platelet-derived growth factor-inducible protein KC; Gro1; CINC-1
• Gene ID: 81503
• mRNA Refseq: NM_030845
• Protein Refseq: NP_110472
• UniProt ID: G3V6C6