Active GMP Recombinant Human IL9 protein

Cat.No. : IL9-4324HG
Product Overview : Recombinant Human IL9 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) transformed T cell line. It functions through the IL-9 receptor, which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 can support the growth of IL-2 independent and IL-4 independent helper T-cells. Human IL-9 has approximately 56 % amino acid sequence identity with murine IL-9. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyper-responsiveness.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human MO7e cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10^6 IU/mg.
Molecular Mass : Approximately 14.1 kDa, a single non-glycosylated polypeptide chain containing 126 amino acids.
AA Sequence : QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Endotoxin : Less than 1 EU/µg of rHuIL-9 as determined by LAL method.
Purity : > 95 % by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution : Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement : Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name IL9 interleukin 9 [ Homo sapiens (human) ]
Official Symbol IL9
Synonyms P40; HP40; IL-9; Cytokine P40, T-cell Growth Factor P40
Gene ID 3578
mRNA Refseq NM_000590.1
Protein Refseq NP_000581.1
MIM 146931
UniProt ID P15248

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL9 Products

Required fields are marked with *

My Review for All IL9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon