Recombinant Rat Il9 protein
Cat.No. : | Il9-2171R |
Product Overview : | Recombinant Rat Il9 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 127 |
Description : | Cytokine involved in mast cell and megakaryioblastic leukemic cell proliferation and hemopoietic cell growth; human homolog may be involved in Hodgkins disease, malignant lymphoma, and asthma. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine TS1 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 14.3 kDa, a single non-glycosylated polypeptide chain containing 127 amino acids. |
AA Sequence : | MQRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA |
Endotoxin : | Less than 0.1 EU/µg of rRtIL-9 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il9 |
Official Symbol | Il9 |
Synonyms | IL9; interleukin 9; interleukin-9; |
Gene ID | 116558 |
mRNA Refseq | NM_001105747 |
Protein Refseq | NP_001099217 |
UniProt ID | D4A8I9 |
◆ Recombinant Proteins | ||
IL9-28162TH | Recombinant Human IL9, His-tagged | +Inquiry |
IL9-8181M | Recombinant Mouse IL9 Protein | +Inquiry |
IL9-668H | Recombinant Human IL9 protein, His & T7-tagged | +Inquiry |
IL9-5704HF | Recombinant Full Length Human IL9 Protein, GST-tagged | +Inquiry |
IL9-2328R | Recombinant Rhesus monkey IL9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il9 Products
Required fields are marked with *
My Review for All Il9 Products
Required fields are marked with *
0
Inquiry Basket