Recombinant Rat Il9 protein

• Cat.No.: Il9-2171R
• Product Overview: Recombinant Rat Il9 protein was expressed in Escherichia coli.

Specification

• Description: Cytokine involved in mast cell and megakaryioblastic leukemic cell proliferation and hemopoietic cell growth; human homolog may be involved in Hodgkins disease, malignant lymphoma, and asthma.
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine TS1 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 14.3 kDa, a single non-glycosylated polypeptide chain containing 127 amino acids.
• Protein length: 127
• AA Sequence: MQRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA
• Endotoxin: Less than 0.1 EU/µg of rRtIL-9 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Il9
• Official Symbol: Il9
• Synonyms: IL9; interleukin 9; interleukin-9
• Gene ID: 116558
• mRNA Refseq: NM_001105747
• Protein Refseq: NP_001099217
• UniProt ID: D4A8I9