Active GMP Recombinant Human IL11 protein

• Cat.No.: IL11-4326HG
• Product Overview: Recombinant Human IL11 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Interleukin-11 (IL-11) is encoded by the IL11 gene and is a member of IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. It is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. The functions of IL-11 are that it directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induces megakaryocyte maturation resulting in increased platelet production.
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine B9-11 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg.
• Molecular Mass: Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids.
• AA Sequence: MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Endotoxin: Less than 1 EU/µg of rHuIL-11 as determined by LAL method.
• Purity: > 95 % by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: IL11 interleukin 11 [ Homo sapiens ]
• Official Symbol: IL11
• Synonyms: IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11
• Gene ID: 3589
• mRNA Refseq: NM_000641
• Protein Refseq: NP_000632
• MIM: 147681
• UniProt ID: P20809