Recombinant Zebrafish EZR Protein (C-ERMAD domain), His tagged

• Cat.No.: EZR-17H
• Product Overview: Recombinant Zebrafish EZR Protein (C-ERMAD domain) with His tag was expressed in E. coli.

Specification

• Species: Zebrafish
• Source: E.coli
• Tag: His
• Description: The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene.
• Molecular Mass: The protein has a calculated MW of 14 kDa.
• AA Sequence: MHHHHHHHHHHMTAPPLPPPPPAYDHDENDLDDGEESNGSYTADLQTGGFNDHRLEEERITEAEKNERVQKQLLALTSELAQARDDTKKTQNDLLHTENVRAGRDKYKTLRQIRQGNTKQRI
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.11 mg/mL by BCA
• Storage Buffer: Sterile 20 mM Tris, pH 8.0, 300 mM NaCl, 10% Glycerol

Gene Information

• Gene Name: EZR ezrin [ Homo sapiens (human) ]
• Official Symbol: EZR
• Synonyms: EZR; ezrin; CVL; CVIL; VIL2; HEL-S-105; ezrin; cytovillin 2; epididymis secretory protein Li 105; p81; villin 2 (ezrin)
• Gene ID: 7430
• mRNA Refseq: NM_003379
• Protein Refseq: NP_003370
• MIM: 123900
• UniProt ID: P15311