Recombinant Yeast SAP2 protein, His-tagged
Cat.No. : | SAP2-6743Y |
Product Overview : | Recombinant Yeast SAP2 protein(P0CS83)(57-398aa(L273V)), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yeast |
Source : | E.coli |
Tag : | His |
ProteinLength : | 57-398a.a.(L273V) |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.4 kDa |
AASequence : | QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLVDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASSISALT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
DPP4-040H | Recombinant Human DPP4 Protein, His-tagged | +Inquiry |
FZD2-26287TH | Recombinant Human FZD2 | +Inquiry |
GPR161-5471HF | Recombinant Full Length Human GPR161 Protein | +Inquiry |
RPSA-1146B | Recombinant Bacillus subtilis RPSA protein, His-tagged | +Inquiry |
ATP5G3-2137M | Recombinant Mouse ATP5G3 Protein | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
◆ Cell & Tissue Lysates | ||
C18orf54-8219HCL | Recombinant Human C18orf54 293 Cell Lysate | +Inquiry |
ZNHIT1-2095HCL | Recombinant Human ZNHIT1 cell lysate | +Inquiry |
RIC8A-2340HCL | Recombinant Human RIC8A 293 Cell Lysate | +Inquiry |
COX6A1-7331HCL | Recombinant Human COX6A1 293 Cell Lysate | +Inquiry |
Gallbladder-194R | Rhesus monkey Gallbladder Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAP2 Products
Required fields are marked with *
My Review for All SAP2 Products
Required fields are marked with *
0
Inquiry Basket