Recombinant Yeast RPB5 Protein (1-215 aa), His-tagged
Cat.No. : | RPB5-2586Y |
Product Overview : | Recombinant Yeast (Kluyveromyces marxianus) (Candida kefyr) RPB5 Protein (1-215 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yeast |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-215 aa |
Description : | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.0 kDa |
AA Sequence : | MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | RPB5; |
UniProt ID | Q9P4B9 |
◆ Recombinant Proteins | ||
RPB5-2586Y | Recombinant Yeast RPB5 Protein (1-215 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPB5 Products
Required fields are marked with *
My Review for All RPB5 Products
Required fields are marked with *
0
Inquiry Basket