Recombinant Xenopus laevis WNT8A.L Protein (23-358 aa), His-tagged

Cat.No. : WNT8A.L-1597X
Product Overview : Recombinant Xenopus laevis (African clawed frog) WNT8A.L Protein (23-358 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Xenopus laevis
Source : Yeast
Tag : His
Protein Length : 23-358 aa
Description : Ligand for mbers of the frizzled family of seven transmbrane receptors. Plays a role in ventral mesodermal patterning during bryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 39.7 kDa
AA Sequence : AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name wnt8a.L Wnt family member 8A L homeolog [ Xenopus laevis (African clawed frog) ]
Official Symbol WNT8A.L
Synonyms wnt8; Xwnt8; wnt-8; wnt8a; xwnt-8;
Gene ID 397970
mRNA Refseq NM_001088168
Protein Refseq NP_001081637
UniProt ID P28026

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT8A.L Products

Required fields are marked with *

My Review for All WNT8A.L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon