Recombinant Xenopus laevis WNT8A.L Protein (23-358 aa), His-tagged

• Cat.No.: WNT8A.L-1597X
• Product Overview: Recombinant Xenopus laevis (African clawed frog) WNT8A.L Protein (23-358 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Xenopus laevis
• Source: Yeast
• Tag: His
• Protein Length: 23-358 aa
• Description: Ligand for mbers of the frizzled family of seven transmbrane receptors. Plays a role in ventral mesodermal patterning during bryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.7 kDa
• AA Sequence: AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: wnt8a.L Wnt family member 8A L homeolog [ Xenopus laevis (African clawed frog) ]
• Official Symbol: WNT8A.L
• Synonyms: wnt8; Xwnt8; wnt-8; wnt8a; xwnt-8
• Gene ID: 397970
• mRNA Refseq: NM_001088168
• Protein Refseq: NP_001081637
• UniProt ID: P28026