Recombinant Wheat GLU-1D-1D protein, His-tagged
Cat.No. : | GLU-1D-1D-3849W |
Product Overview : | Recombinant Wheat GLU-1D-1D protein(P10388)(22-194aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Wheat |
Source : | E.coli |
Tag : | His |
ProteinLength : | 22-194aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | EGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQPRYYPTSPQQSGQLQQPAQGQQPGQGQQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
DCTN3-1195R | Recombinant Rhesus monkey DCTN3 Protein, His-tagged | +Inquiry |
WNK2-10188M | Recombinant Mouse WNK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Aspscr1-1752M | Recombinant Mouse Aspscr1 Protein, Myc/DDK-tagged | +Inquiry |
MATN3-3209H | Recombinant Human MATN3 protein, His&Myc-tagged | +Inquiry |
S-5495S | Recombinant SARS-CoV-2 RBD (E484K, Arg319-Phe541) Protein, C-His tagged | +Inquiry |
◆ Native Proteins | ||
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAS2L3-688HCL | Recombinant Human GAS2L3 cell lysate | +Inquiry |
SPIN1-1515HCL | Recombinant Human SPIN1 293 Cell Lysate | +Inquiry |
R3HDM4-8214HCL | Recombinant Human C19orf22 293 Cell Lysate | +Inquiry |
SPATA3-625HCL | Recombinant Human SPATA3 lysate | +Inquiry |
FXC1-6109HCL | Recombinant Human FXC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GLU-1D-1D Products
Required fields are marked with *
My Review for All GLU-1D-1D Products
Required fields are marked with *
0
Inquiry Basket