Recombinant West Nile Virus Pre-M Protein, C-6×His tagged

• Cat.No.: Pre-M-10W
• Product Overview: The E.coli derived 20 kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with C-6×His tag.

Specification

• Species: West Nile Virus
• Source: E.coli
• Tag: His
• Description: West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopy reveal a 45-50 nm virion covered with a relatively smooth protein surface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDa protein blocks; the capsid is contained within a hostderived membrane altered by two viral glycoproteins
• AA Sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
• Purity: > 90% pure by SDS-PAGE.
• Applications: Western Blot, ELISA, etc.
• Storage: Store at -20 centigrade and avoid freeze-thaw cycles.
• Storage Buffer: 20 mM phosphate buffer pH7.5
• Shipping: Protein is shipped at ambient temperature.

Gene Information

• Official Symbol: Pre-M
• Synonyms: Pre-M