Recombinant Vaccinia Virus VACWR034 Protein (1-88 aa), His-tagged

• Cat.No.: VACWR034-1949V
• Product Overview: Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) VACWR034 Protein (1-88 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: VACV
• Source: Yeast
• Tag: His
• ProteinLength: 1-88 aa
• Description: Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.6 kDa
• AA Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: K3L temporal expression: early [ Vaccinia virus ]
• Official Symbol: VACWR034
• Synonyms: VACWR034; Protein K2
• Gene ID: 3707649
• Protein Refseq: YP_232916
• UniProt ID: P18378