Recombinant Vaccinia Virus L3L Protein (1-350 aa), His-tagged

• Cat.No.: L3L-2086V
• Product Overview: Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) L3L Protein (1-350 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: VACV
• Source: Yeast
• Tag: His
• Protein Length: 1-350 aa
• Description: Might be required for transcription of early genes.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 42.6 kDa
• AA Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: L3L hypothetical protein [ Vaccinia virus ]
• Official Symbol: L3L
• Synonyms: VACWR090; Protein F4
• Gene ID: 3707546
• Protein Refseq: YP_232972
• UniProt ID: P07614