Recombinant Vaccinia Virus L1R Protein (2-183 aa), His-tagged

• Cat.No.: L1R-2603V
• Product Overview: Recombinant Vaccinia Virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) L1R Protein (2-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Source: E. coli
• Species: Vaccinia Virus
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.8 kDa
• Protein length: 2-183 aa
• AA Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: L1R temporal expression: late [ Vaccinia virus ]
• Official Symbol: L1R
• Synonyms: VACWR088
• Gene ID: 3707544
• Protein Refseq: YP_232970
• UniProt ID: P07612