Recombinant Vaccinia Virus E3L Protein (1-190 aa), His-Myc-tagged
| Cat.No. : | E3L-2544V |
| Product Overview : | Recombinant Vaccinia Virus (strain Copenhagen) (VACV) E3L Protein (1-190 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | VACV |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-190 aa |
| Description : | The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.5 kDa |
| AA Sequence : | MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | E3L temporal expression: early [ Vaccinia virus ] |
| Official Symbol | E3L |
| Synonyms | E3L; |
| Gene ID | 3707592 |
| UniProt ID | P21081 |
| ◆ Recombinant Proteins | ||
| E3L-2544V | Recombinant Vaccinia Virus E3L Protein (1-190 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All E3L Products
Required fields are marked with *
My Review for All E3L Products
Required fields are marked with *
0
Inquiry Basket
