Recombinant Vaccinia Virus B18R Protein, His-tagged

• Cat.No.: B18R-755V
• Product Overview: Recombinant Vaccinia Virus B18R protein with His tag was expressed in HEK293.

Specification

• Species: VACV
• Source: HEK293
• Tag: His
• Protein Length: 351
• Description: The B18R protein is a vaccinia virus-encoded receptor with specificity for mouse, human, rabbit, pig, rat, and cow type I interferons which has potent neutralizing activity. B18R that acts as a decoy receptor for Type I Interferons (IFNa, IFNb, IFNe,k,t,d,z,w,v). B18R was recently identified to enable increased cell viability during RNA transfection protocols designed to convert human somatic donor cells into iPSCs via direct delivery of modified synthetic mRNAs for OCT4, SOX2, KLF4 and MYC (OSKM) and Lin28 with the aim to enable highly efficient reprogramming of somatic cells to pluripotency. This allows for re-directed differentiation toward a desired lineage while removing the risk of genomic integration and insertional mutagenesis inherent to DNA-bases methodologies and eliminates the need for virus-based approaches. iPSCs represent a widely available, non-controversial and practically infinite source of pluripotent cells.
• Form: Lyophilized
• Molecular Mass: 40.3 kDa
• AA Sequence: MTMKMMVHIYFVSLLLLLFHSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Official Symbol: B18R
• Synonyms: VACWR200; B18R