Recombinant V. vulnificus Fe/S biogenesis protein NfuA Protein, His-tagged

• Cat.No.: NfuA-1293V
• Product Overview: Recombinant Vibrio vulnificus (strain CMCP6) Fe/S biogenesis protein NfuA Protein (1-194aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: V.vulnificus
• Source: E.coli
• Tag: His
• ProteinLength: 1-194 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 25.0 kDa
• AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDEL
  SLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDA
  GVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: BJE04_RS01410 Fe-S biogenesis protein NfuA [ Vibrio vulnificus YJ016 ]
• Official Symbol: Fe/S biogenesis protein NfuA
• Synonyms: Fe/S biogenesis protein NfuA; BJE04_RS01410; NfuA
• Gene ID: 2622994
• Protein Refseq: WP_026050270.1
• UniProt ID: Q8DDU2