Recombinant V. vulnificus Fe/S biogenesis protein NfuA Protein, His-tagged
Cat.No. : | NfuA-1293V |
Product Overview : | Recombinant Vibrio vulnificus (strain CMCP6) Fe/S biogenesis protein NfuA Protein (1-194aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | V.vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-194 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 25.0 kDa |
AA Sequence : | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDEL SLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDA GVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | BJE04_RS01410 Fe-S biogenesis protein NfuA [ Vibrio vulnificus YJ016 ] |
Official Symbol | Fe/S biogenesis protein NfuA |
Synonyms | Fe/S biogenesis protein NfuA; BJE04_RS01410; NfuA |
Gene ID | 2622994 |
Protein Refseq | WP_026050270.1 |
UniProt ID | Q8DDU2 |
◆ Recombinant Proteins | ||
GM12824-3641M | Recombinant Mouse GM12824 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL36A-151H | Recombinant Human IL36A Protein, His-tagged | +Inquiry |
PPP2R5A-31104TH | Recombinant Human PPP2R5A | +Inquiry |
CPN1-1931M | Recombinant Mouse CPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPA1-2118R | Recombinant Rhesus monkey HNRNPA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
B. abortus-23 | Native Brucella abortus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCMDC2-258HCL | Recombinant Human MCMDC2 cell lysate | +Inquiry |
TMEM211-684HCL | Recombinant Human TMEM211 lysate | +Inquiry |
ACBD4-9106HCL | Recombinant Human ACBD4 293 Cell Lysate | +Inquiry |
RUFY4-1551HCL | Recombinant Human RUFY4 cell lysate | +Inquiry |
UROS-482HCL | Recombinant Human UROS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fe/S biogenesis protein NfuA Products
Required fields are marked with *
My Review for All Fe/S biogenesis protein NfuA Products
Required fields are marked with *
0
Inquiry Basket