Recombinant Tick-borne encephalitis virus Genome protein, His-KSI-tagged
Cat.No. : | Genome-3728T |
Product Overview : | Recombinant Tick-borne encephalitis virus Genome protein(A0A075TBC5)(302-400aa), fused to N-terminal His-KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tick-born Encephalitis Virus |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 302-400aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | GLTYTMCDKTKFTWKRIPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGSPDVNVAMLITP NPTIETNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Genome-3811M | Recombinant Mucosal disease virus Genome protein, His-tagged | +Inquiry |
Genome-4123C | Recombinant Coxsackievirus B3 (strain Nancy) Genome protein(1724-2185aa), His-tagged | +Inquiry |
Genome-895W | Recombinant West Nile virus (WNV) Genome protein(1502-2120aa), His-tagged | +Inquiry |
Genome-77D | Recombinant Dengue virus type 2 Genome protein, His-tagged | +Inquiry |
Genome-5579M | Recombinant Mucosal disease virus Genome protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Genome Products
Required fields are marked with *
My Review for All Genome Products
Required fields are marked with *
0
Inquiry Basket