Recombinant Thauera selenatis TXNRD1 Protein

• Cat.No.: TXNRD1-109T
• Product Overview: Recombinant Thauera selenatis TXNRD1 Protein was expressed in E.coli.

Specification

• Description: The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.
• Source: E. coli
• Species: Thauera selenatis
• Form: PBS, pH 7.4.
• Molecular Mass: 25.5 kDa
• AA Sequence: MHHHHHHHHHHADGAPAAQRTIQVLSVKGGDAASPQAAVWKKAPTGQVALQTAFPGHASIVGTALTQQMTAQAVRAGDRLFVRLAWRDATANTEIKDTDQFVDGAAVQFPVNGKDTTLAFMGDPDNPVNVWHWRADGRTRNLVAKGFGTATPVPAEGLRSTATRTRDGWEVVISRPLRVKAEEGADLQGRRTMPIAFAAWDGENQERDGLKAVTMEWWQLNFEQKLISEEDL
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.35 mg/mL

Gene Information

• Official Symbol: TXNRD1
• Synonyms: TR; TR1; TXNR; TRXR1; GRIM-12; TR; TR1; TXNR; TRXR1; GRIM-12
• UniProt ID: Q9S1G7