Source :	Insect Cells
Tag :	Non
Form :	Liquid. In Tris-Hcl PH8.0.
Molecular Mass :	(Theoretical molecular weight)~36.4kDa
AA sequence :	MRSTEVGRVVEDFIVLPPTPKSKWKLSDFELLHKLGGGNYGDVHLASVKDCNFVCALKRLSIKKLADFDIATQLRREIEIAFNTRHKYLLRTYAYFFDETDIYLIMEPCSNGMLYTELNRVKCFAPPTAARYVAQLAEALLYLHQHHILHRDIKPENILLDHNNNIKLADFGWSVHDPDNRRKTSCGTPEYFPPEIVGRQAYDTSADLWCLGIFCYELLVGKTPFVGKDTDQICKNIHSMHFKIPENIPSEAKDLIANLLLRDGSRRLALHRVVNHQFLLKYYYLPNNLQPPTGKRPRLDAEPTAGKENHHHHHH
Purity :	>85% as determined by SDS-PAGE
Storage :	Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration :	0.3 mg/ml

◆ Recombinant Proteins
RFL31753SF	Recombinant Full Length Sheeppox Virus G-Protein Coupled Receptor Homolog Q2/3L(Q2/3L) Protein, His-Tagged	+Inquiry
RFL33856MF	Recombinant Full Length Mouse Synaptotagmin-1(Syt1) Protein, His-Tagged	+Inquiry
TAX1BP1-3117H	Recombinant Human TAX1BP1, His-tagged	+Inquiry
Thy1-8780R	Recombinant Rat Thy1 protein(Met1-Lys129), His-tagged	+Inquiry
TUFM-310H	Recombinant Human TUFM, GST-tagged	+Inquiry
See All Q2/3L Recombinant Proteins

◆ Native Proteins
Urease-53J	Active Native Jack Bean Urease	+Inquiry
CGB-8048H	Native Human Urine Beta Chorionic Gonadotropin (b-hCG)	+Inquiry
pla2-839S	Active Native Snake Phospholipase A2 protein	+Inquiry
CP-5326H	Native Human Ceruloplasmin (ferroxidase)	+Inquiry
GC-524H	Native Human GC protein	+Inquiry
See All Urease Native Proteins

◆ Cell & Tissue Lysates
TNFRSF4-2422HCL	Recombinant Human TNFRSF4 cell lysate	+Inquiry
KIF14-925HCL	Recombinant Human KIF14 cell lysate	+Inquiry
SEPT12-1964HCL	Recombinant Human SEPT12 293 Cell Lysate	+Inquiry
BRD2-177HCL	Recombinant Human BRD2 cell lysate	+Inquiry
METTL6-1084HCL	Recombinant Human METTL6 cell lysate	+Inquiry
See All TNFRSF4 Cell & Tissue Lysates