Recombinant SUMO Protein, His tagged

• Cat.No.: SUMO-02
• Product Overview: Sumo tag (Ubiquitin-like protein) Protein (His-Tag)

Specification

• Source: E.coli
• Tag: His&Non
• Form: Liquid
• Molecular Mass: 14.13 kDa
• Purity: > 90% by SDS-PAGE
• N-terminal Sequence Analysis: Met
• AA Sequence: MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIG
• Note: For laboratory use only. Not for household use.
• Storage: Samples are stable for twelve months from date of receipt at -20 to -80 centigrade. Store it under sterile conditions at -20 to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: PBS pH 7.4
• Concentration: 0.5 mg/mL