Recombinant Sulfolobus Solfataricus SSO7D Protein (2-64 aa), His-tagged
Cat.No. : | SSO7D-1591S |
Product Overview : | Recombinant Sulfolobus Solfataricus (strain ATCC 35092/DSM 1617/JCM 11322/P2) SSO7D Protein (2-64 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sulfolobus Solfataricus |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-64 aa |
Description : | Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 9.1 kDa |
AA Sequence : | ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | sso7d; 7 kDa DNA-binding protein dSso7d; |
UniProt ID | P39476 |
◆ Recombinant Proteins | ||
SSO7D-1591S | Recombinant Sulfolobus Solfataricus SSO7D Protein (2-64 aa), His-tagged | +Inquiry |
SSO7D-912S | Recombinant Sulfolobus Solfataricus SSO7D Protein (2-64 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSO7D Products
Required fields are marked with *
My Review for All SSO7D Products
Required fields are marked with *
0
Inquiry Basket