Recombinant Sulfolobus Islandicus CREN7 Protein (1-60 aa), GST-tagged

• Cat.No.: CREN7-979S
• Product Overview: Recombinant Sulfolobus Islandicus (strain L.S.2.15/Lassen #1) CREN7 Protein (1-60 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Sulfolobus Islandicus
• Source: E.coli
• Tag: GST
• ProteinLength: 1-60 aa
• Description: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 33.6 kDa
• AA Sequence: MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• UniProt ID: C3MPN0