Recombinant Sulfolobus Islandicus CREN7 Protein (1-60 aa), GST-tagged
Cat.No. : | CREN7-979S |
Product Overview : | Recombinant Sulfolobus Islandicus (strain L.S.2.15/Lassen #1) CREN7 Protein (1-60 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sulfolobus Islandicus |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-60 aa |
Description : | A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | C3MPN0 |
◆ Recombinant Proteins | ||
CREN7-979S | Recombinant Sulfolobus Islandicus CREN7 Protein (1-60 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CREN7 Products
Required fields are marked with *
My Review for All CREN7 Products
Required fields are marked with *
0
Inquiry Basket