Recombinant Streptomyces alboniger pac protein, His-tagged
Cat.No. : | pac-3859S |
Product Overview : | Recombinant Streptomyces alboniger pac protein(P13249)(1-199aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces alboniger |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-199aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
ARF3-749R | Recombinant Rat ARF3 Protein | +Inquiry |
IL22RA1-3603H | Recombinant Human IL22RA1 Protein (Gln267-Gly565), N-His tagged | +Inquiry |
FAM234A-2501H | Recombinant Human FAM234A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF574-5153R | Recombinant Rhesus Macaque ZNF574 Protein, His (Fc)-Avi-tagged | +Inquiry |
NI36-RS09305-0880S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS09305 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
C-type lectin like protein-043H | Native Hen C-type lectin like protein Protein, Peroxidase conjugated | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IQCD-5179HCL | Recombinant Human IQCD 293 Cell Lysate | +Inquiry |
ARSD-8676HCL | Recombinant Human ARSD 293 Cell Lysate | +Inquiry |
TMSB15B-905HCL | Recombinant Human TMSB15B 293 Cell Lysate | +Inquiry |
OVOL1-1263HCL | Recombinant Human OVOL1 cell lysate | +Inquiry |
ENTPD4-6592HCL | Recombinant Human ENTPD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pac Products
Required fields are marked with *
My Review for All pac Products
Required fields are marked with *
0
Inquiry Basket