Recombinant Staphylokinase (SAK) protein

• Cat.No.: SAK-05S
• Product Overview: Recombinant Staphylokinase (SAK) protein was expressed in Escherichia coli.

Specification

• Description: Staphylokinase is an amino acid enzyme secreted by several species of streptococci. It is a 16kDa potent plasminogen activator that converts plasminogen into plasmin which can digest fibrin the major constituent of blood thrombi. SAK forms 1:1 complex with plasmin, which is a positive feedback of producing other complexes. Recent studies on the thrombolytic potential of recombinant SAK in achieving early perfusion in myocardial infarction and in the dissolution of platelet-rich clot have clearly established its immense utility in clinical medicine as a thrombolytic agent and suggested that it can be developed as a potent clot-dissolving agent.
• Source: E.coli
• Species: Staphylococcus phage phiN315
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The specific activity determined by fibrining lysis in agarose plate is 5.0 × 10⁴ IU/mg.
• Molecular Mass: Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 136 amino acids.
• Protein length: 136
• AA Sequence: SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
• Endotoxin: Less than 1 EU/µg of rSAK as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: SAK
• Official Symbol: SAK
• Synonyms: Sak42D
• Gene ID: 1260563
• Protein Refseq: NP_835575.1