Recombinant Staphylococcus aureus Staphopain B Protein, GST-tagged

• Cat.No.: SSPB-198S
• Product Overview: Recombinant Staphylococcus aureus Staphopain B(220-393aa) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Staphylococcus aureus
• Source: E.coli
• Tag: GST
• Protein Length: 220-393aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 46.9kDa
• AA Sequence: DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.