Recombinant Staphylococcus Aureus SSAA2 Protein (28-267 aa), His-SUMO-tagged

• Cat.No.: SSAA2-2028S
• Product Overview: Recombinant Staphylococcus Aureus (strain Mu50/ATCC 700699) SSAA2 Protein (28-267 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Staphylococcus Aureus
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 28-267 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 42.7 kDa
• AA Sequence: SEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: ssaA2
• UniProt ID: Q99RX4