Recombinant Staphylococcus Aureus PRSA Protein (21-320 aa), His-SUMO-tagged

• Cat.No.: PRSA-1968S
• Product Overview: Recombinant Staphylococcus Aureus (strain COL) PRSA Protein (21-320 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Staphylococcus Aureus
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 21-320 aa
• Description: Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.6 kDa
• AA Sequence: CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: prsA
• UniProt ID: Q5HET4