Recombinant Staphylococcus Aureus ENTH Protein (25-241 aa), His-tagged

• Cat.No.: ENTH-2099S
• Product Overview: Recombinant Staphylococcus Aureus ENTH Protein (25-241 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Staphylococcus Aureus
• Source: Yeast
• Tag: His
• ProteinLength: 25-241 aa
• Description: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.6 kDa
• AA Sequence: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: entH; SHE
• UniProt ID: P0A0M0