Recombinant Staphylococcus Aureus ENTC1 Protein (28-266 aa), His-SUMO-tagged
Cat.No. : | ENTC1-966S |
Product Overview : | Recombinant Staphylococcus Aureus ENTC1 Protein (28-266 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Aureus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 28-266 aa |
Description : | Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 43.5 kDa |
AA Sequence : | ESQPDPTPDELHKASKFTGLMENMKVLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEGLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P01553 |
◆ Recombinant Proteins | ||
ENTC1-966S | Recombinant Staphylococcus Aureus ENTC1 Protein (28-266 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTC1 Products
Required fields are marked with *
My Review for All ENTC1 Products
Required fields are marked with *
0
Inquiry Basket