Recombinant Spiroplasma Citri SPI Protein (24-241 aa), His-SUMO-tagged

• Cat.No.: SPI-1985S
• Product Overview: Recombinant Spiroplasma Citri SPI Protein (24-241 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. rotein Description: Full Length of Mature Protein.

Specification

• Species: Spiroplasma Citri
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 24-241 aa
• Description: Major membrane protein of spiroplasma.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.0 kDa
• AA Sequence: CNKTESNNLSIVKTIAVPATVATANPKQVTNAEIKTALEANVLKAVQGVVKTATAADFQFDVYQDNKGTSLTTINLEEGNVEVYVQITPAKDKTVVIGETGYIKVTLPKIKVDISGVVIDQQIVEIKAADPKQVTKDELNAVNTYATLASAVLEAIKNKAPNAGASDFEITNNCDAGDYSAQKDVKVTVKAKDESPNISGEFKVNAKVKATLAPPKAG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: spi
• UniProt ID: P19215