Recombinant Spiroplasma Citri SPI Protein (24-241 aa), His-SUMO-tagged
Cat.No. : | SPI-1985S |
Product Overview : | Recombinant Spiroplasma Citri SPI Protein (24-241 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. rotein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Spiroplasma Citri |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-241 aa |
Description : | Major membrane protein of spiroplasma. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.0 kDa |
AA Sequence : | CNKTESNNLSIVKTIAVPATVATANPKQVTNAEIKTALEANVLKAVQGVVKTATAADFQFDVYQDNKGTSLTTINLEEGNVEVYVQITPAKDKTVVIGETGYIKVTLPKIKVDISGVVIDQQIVEIKAADPKQVTKDELNAVNTYATLASAVLEAIKNKAPNAGASDFEITNNCDAGDYSAQKDVKVTVKAKDESPNISGEFKVNAKVKATLAPPKAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | spi; |
UniProt ID | P19215 |
◆ Recombinant Proteins | ||
spi-3726L | Recombinant Lentinus edodes spi protein, His-SUMO-tagged | +Inquiry |
SPI-1985S | Recombinant Spiroplasma Citri SPI Protein (24-241 aa), His-SUMO-tagged | +Inquiry |
spi-3725L | Recombinant Lentinus edodes spi protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPI Products
Required fields are marked with *
My Review for All SPI Products
Required fields are marked with *
0
Inquiry Basket