Recombinant Spinach PETE Protein (70-168 aa), His-SUMO-tagged

• Cat.No.: PETE-2478S
• Product Overview: Recombinant Spinach (Spinacia oleracea) PETE Protein (70-168 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Spinach
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 70-168 aa
• Description: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.4 kDa
• AA Sequence: VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: PETE
• UniProt ID: P00289