Recombinant SPE248 Protein, His-tagged
Cat.No. : | SPE248-62 |
Product Overview : | Recombinant SPE248 Protein fused with a His tag. |
Availability | April 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Molecular Mass : | The protein has a calculated MW of 17 kDa. |
AA Sequence : | MHTVIWSIKIIDSFSGMACLASTVASILPEQSGRQINNSQPSSVARPIKWEAVTAAPLVERAEVKAAQGDTLEKRFGCIDPLVSVDVLNRGNGARGSLLDVNILNGFLKDAQKKSQLTPFSITRQAIPQTYGEHIHRTNCHAEASSVFIHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.2 mg/mL |
Storage Buffer : | PBS pH7.4 |
Official Symbol | SPE248 |
Synonyms | SPE248 |
◆ Recombinant Proteins | ||
SPE248-62 | Recombinant SPE248 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPE248 Products
Required fields are marked with *
My Review for All SPE248 Products
Required fields are marked with *
0
Inquiry Basket