Recombinant Slime mold DDB Full Length Transmembrane protein, His-tagged
Cat.No. : | DDB-204S |
Product Overview : | Recombinant Slime mold DDB protein(Q54VH7)(1-375aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Slime mold |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-375aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLWYTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVNLYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGKWSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSFFPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASFGILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYNLIIPYYKRKINKLNK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
IgG-341D | Native Dog IgG | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf7-8111HCL | Recombinant Human C20orf7 293 Cell Lysate | +Inquiry |
ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
NTF3-3670HCL | Recombinant Human NTF3 293 Cell Lysate | +Inquiry |
ZNF124-144HCL | Recombinant Human ZNF124 293 Cell Lysate | +Inquiry |
PPP1R3C-2934HCL | Recombinant Human PPP1R3C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DDB Products
Required fields are marked with *
My Review for All DDB Products
Required fields are marked with *
0
Inquiry Basket