Recombinant SiOle3,3 protein, N-10×His tagged

• Cat.No.: SiOle3,3-04
• Product Overview: Recombinant SiOle3,3 protein with N-10×His tag was expressed in E. coli.

Specification

• Source: E.coli
• Tag: His
• Molecular Mass: 16.5 kDa
• AA Sequence: MACHYGQQQQTCAPHLQLQPRACRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADCLESAKTKLASCAREMKDRAEQFSCQPVAGSQTS
• Purity: ≥85% by SDS-PAGE
• Applications: MACHYGQQQQTCAPHLQLQPRACRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADCLESAKTKLASCAREMKDRAEQFSCQPVAGSQTS
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS,0.05% Brij-78, 6% Trehalose, pH7.4
  The volume before lyophilization is 100ul/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Official Symbol: SiOle3,3
• Synonyms: SiOle3,3