Recombinant Sheep IL8 Protein (23-101 aa), His-tagged
Cat.No. : | IL8-580S |
Product Overview : | Recombinant Sheep IL8 Protein (23-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-101 aa |
Description : | IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 13.1 kDa |
AA Sequence : | AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | IL8 interleukin 8 [ Ovis aries ] |
Official Symbol | IL8 |
Synonyms | IL8; interleukin 8; interleukin-8; IL-8; |
Gene ID | 443418 |
mRNA Refseq | NM_001009401 |
Protein Refseq | NP_001009401 |
UniProt ID | P36925 |
◆ Recombinant Proteins | ||
IL8-2471H | Recombinant Human IL8 Protein (Ala23-Ser99), His tagged | +Inquiry |
IL8-580S | Recombinant Sheep IL8 Protein (23-101 aa), His-tagged | +Inquiry |
IL8-150C | Recombinant Cynomolgus IL8 | +Inquiry |
IL8-311H | Active Recombinant Human interleukin 8, HIgG1 Fc-tagged, mutant | +Inquiry |
IL8-541R | Recombinant Rhesus IL8 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL8-3002HCL | Recombinant Human IL8 cell lysate | +Inquiry |
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
0
Inquiry Basket