Recombinant Sheep GHRH Protein (1-44 aa), GST-tagged

• Cat.No.: GHRH-523S
• Product Overview: Recombinant Sheep GHRH Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Sheep
• Source: E.coli
• Tag: GST
• ProteinLength: 1-44 aa
• Description: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 32.1 kDa
• AA Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: GHRH growth hormone releasing hormone [ Ovis aries (sheep) ]
• Official Symbol: GHRH
• Synonyms: GRF
• Gene ID: 100101237
• UniProt ID: P07217