Recombinant Full Length Human GHRH Protein, GST-tagged

• Cat.No.: GHRH-5252HF
• Product Overview: Human GHRH full-length ORF ( NP_066567.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 108 amino acids
• Description: The protein encoded by this gene belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. [provided by RefSeq
• Molecular Mass: 38.8 kDa
• AA Sequence: MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GHRH growth hormone releasing hormone [ Homo sapiens ]
• Official Symbol: GHRH
• Synonyms: GHRH; growth hormone releasing hormone; GHRF; somatoliberin; sermorelin; somatocrinin; somatorelin; growth hormone-releasing factor; growth hormone-releasing hormone; GRF; INN; MGC119781
• Gene ID: 2691
• mRNA Refseq: NM_001184731
• Protein Refseq: NP_001171660
• MIM: 139190
• UniProt ID: P01286