Recombinant Sesamum orientale Oleosin Full Length Transmembrane protein, His-tagged

• Cat.No.: Oleosin-305S
• Product Overview: Recombinant Sesamum orientale Oleosin protein(Q9XHP2)(1-145aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Sesamum orientale
• Source: E.coli
• Tag: His
• ProteinLength: 1-145aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.7 kDa
• AA Sequence: MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.