Recombinant SARS-CoV 3C Transmembrane protein, His-tagged
Cat.No. : | 3C-832S |
Product Overview : | Recombinant SARS-CoV 3C protein(C8YZ74)(3547-3836aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | SARS-CoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | 3547-3836aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Native Proteins | ||
Tf-264R | Native Rat Transferrin | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
Streptolysin-171S | Native Streptolysin O protein | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPBP1-5342HCL | Recombinant Human HSPBP1 293 Cell Lysate | +Inquiry |
CYP2J2-7110HCL | Recombinant Human CYP2J2 293 Cell Lysate | +Inquiry |
ATP6V1E2-8579HCL | Recombinant Human ATP6V1E2 293 Cell Lysate | +Inquiry |
HAX1-5626HCL | Recombinant Human HAX1 293 Cell Lysate | +Inquiry |
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All 3C Products
Required fields are marked with *
My Review for All 3C Products
Required fields are marked with *
0
Inquiry Basket