Recombinant Salmonella Typhi USPA Protein (2-144 aa), His-tagged

• Cat.No.: USPA-2080S
• Product Overview: Recombinant Salmonella Typhi USPA Protein (2-144 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Salmonella Typhi
• Source: Yeast
• Tag: His
• ProteinLength: 2-144 aa
• Description: Required for resistance to DNA-damaging agents.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.9 kDa
• AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: uspA
• UniProt ID: Q8Z268