Recombinant Salmo keta CSL3 protein, His-tagged
Cat.No. : | CSL3-3799S |
Product Overview : | Recombinant Salmo keta CSL3 protein(P86179)(1-195aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmo keta |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-195aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27 kDa |
AA Sequence : | AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
L1CAM-1276H | Recombinant Human L1CAM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACSS3-1237M | Recombinant Mouse ACSS3 Protein | +Inquiry |
NCAM1-691H | Recombinant Human NCAM1 Protein, His and C-hFc-tagged | +Inquiry |
POU2F1B-5489Z | Recombinant Zebrafish POU2F1B | +Inquiry |
RFL28405TF | Recombinant Full Length Thiobacillus Denitrificans Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
◆ Cell & Tissue Lysates | ||
UACC62-066WCY | Human Skin Melanoma UACC62 Whole Cell Lysate | +Inquiry |
TRA2B-827HCL | Recombinant Human TRA2B 293 Cell Lysate | +Inquiry |
SLC25A44-1760HCL | Recombinant Human SLC25A44 293 Cell Lysate | +Inquiry |
SYNGR1-1318HCL | Recombinant Human SYNGR1 293 Cell Lysate | +Inquiry |
MINOS1-8178HCL | Recombinant Human C1orf151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSL3 Products
Required fields are marked with *
My Review for All CSL3 Products
Required fields are marked with *
0
Inquiry Basket